Cart summary

You have no items in your shopping cart.

Amylin (1-37) Peptide

SKU: orb72218

Description

This product is Amylin (1-37) Peptide. Its protein sequence is KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2, disulfide bonds:C2=C7. Purification is performed using HPLC.

Images & Validation

Key Properties

Protein SequenceKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2, disulfide bonds:C2=C7
PurificationHPLC

Storage & Handling

StorageShipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.
Form/AppearanceLyophilized
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Islet amyloid polypeptide; IAPP; Amylin 1-37;Amylin(1-37);

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Amylin (1-37) Peptide (orb72218)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

500 μg
$ 310.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry