You have no items in your shopping cart.
Amylin (1-37) Peptide
SKU: orb72218
Description
Images & Validation
−
Key Properties
−| Protein Sequence | KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2, disulfide bonds:C2=C7 |
|---|---|
| Purification | HPLC |
Storage & Handling
−| Storage | Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Islet amyloid polypeptide; IAPP; Amylin 1-37;Amylin(1-37);
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Amylin (1-37) Peptide (orb72218)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review