You have no items in your shopping cart.
Cart summary
AMBRA1 Peptide - C-terminal region
Catalog Number: orb1998077
| Catalog Number | orb1998077 |
|---|---|
| Category | Proteins |
| Description | AMBRA1 Peptide - C-terminal region |
| Predicted Reactivity | Mouse |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: ERTVGVAFNQETGHWERIYTQSSRSGTVSQEALHQDMPEESSEEDSLRRL |
| UniProt ID | A2AH22 |
| MW | 82 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | activating molecule in BECN1-regulated autophagy p Read more... |
| Note | For research use only |
| NCBI | NP_001074223.1 |
