Aldosterone Secretion Inhibiting Factor (1-35) (bovine)

SKU: orb2692926

Description

A natriuretic factor isolated from chromaffin cells that is an agonist at NPR receptors that inhibit aldosterone production. Closely related in structure to brain natriuretic peptide (BNP).

Research Area

Pharmacology & Drug Discovery

Images & Validation

−

Key Properties

−

MW	3910.64
Purity	≥95%
Formula	C₁₆₄H₂₇₈N₅₈O₄₅S₄
Protein Sequence	ALRGPKMMRNDSGCFGRRLDRIGSLSGLGCNVLRRY(Disulfide bridge:Cys13-Cys29)

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols