You have no items in your shopping cart.
ALDH2 Antibody
SKU: orb1176969
Description
Images & Validation
−
| Tested Applications | IHC-P, WB |
|---|---|
| Dilution Range | Western blot: 0.1-0.5μg/ml. Immunohistochemistry(Paraffin-embedded Section): 0.5-1μg/ml |
| Reactivity | Human, Mouse, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid. |
| Target | ALDH2 |
| Purification | Immunogen affinity purified. |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | Antibody is lyophilized with 5 mg rAlbumin, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Acetaldehyde dehydrogenase 2 antibody, Aldehyde dehydrogenase 2 family (mitochondrial) antibody, Aldehyde dehydrogenase 2 family antibody, Aldehyde dehydrogenase mitochondrial antibody, Aldehyde dehydrogenase, mitochondrial antibody, ALDH 2 antibody, ALDH class 2 antibody, ALDH E2 antibody, ALDH-E2 antibody, Aldh2 antibody, ALDH2_HUMAN antibody, ALDHI antibody, ALDM antibody, Liver mitochondrial ALDH antibody, MGC1806 antibody, Mitochondrial aldehyde dehydrogenase 2 antibody, MS767 antibody, Nucleus encoded mitochondrial aldehyde dehydrogenase 2 antibody
Similar Products
−- Item 1 of 7
- Item 1 of 7
- Item 1 of 4
ALDH2 rabbit pAb Antibody [orb766960]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl - Item 1 of 4
ALDH2 Antibody [orb1939418]
FC, IF, IHC-P, WB
Human, Mouse, Rat
Mouse
Monoclonal
Unconjugated
100 μl, 50 μl - Item 1 of 1
Human Aldehyde Dehydrogenase, Mitochondrial (ALDM) ELISA Kit [orb776618]
Human
0.32-20 ng/mL
0.122 ng/mL
96 T, 48 T
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
ALDH2
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
WB
Western Blot (IB, immunoblot)
IHC-P
Immunohistochemistry Paraffin
ALDH2 Antibody (orb1176969)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days