You have no items in your shopping cart.
Cart summary
AKR1B1 Peptide - middle region
Catalog Number: orb1997601
| Catalog Number | orb1997601 |
|---|---|
| Category | Proteins |
| Description | AKR1B1 Peptide - middle region |
| Predicted Reactivity | Mouse |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: HSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKYNKTTAQVLI |
| UniProt ID | P45376 |
| MW | 34 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | AR, ALR2, Ahr1, Ahr-1, Aldr1, Akr1b1, Aldor1 |
| Note | For research use only |
| NCBI | NP_033788.3 |
