You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576100 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to AKAP7 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Guinea pig, Porcine, Rabbit |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AKAP7 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 37kDa |
Target | AKAP7 |
UniProt ID | Q9P0M2 |
Protein Sequence | Synthetic peptide located within the following region: DERLAKAMVSDGSFHITLLVMQLLNEDEVNIGIDALLELKPFIEELLQGK |
NCBI | NP_057461 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | AKAP15, AKAP18 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-AKAP7 Antibody, Catalog Number: orb576100, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Membrane, Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-AKAP7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate.
ELISA, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |