AGPAT4 Peptide - middle region

SKU: orb2011864

Description

Images & Validation

−

Tested Applications	WB
Application Notes	This is a synthetic peptide designed for use in combination with AGPAT4 Rabbit Polyclonal Antibody (orb584820). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Key Properties

−

Molecular Weight	44kDa
Protein Sequence	EMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISM

Storage & Handling

−

Storage	Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized powder
Disclaimer	For research use only

Alternative Names

−

1-AGPAT4, LPAAT-delta, dJ473J16.2, RP3-473J16.2

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

UniProt

Q9NRZ5

RefSeq (Protein):NP_064518

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_064518

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols