Ag85B Protein

SKU: orb80904

Description

Recombinant of Ag85B protein

Images & Validation

• Application Notes:
  Recombinant & Natural Proteins

Key Properties

• Source: Escherichia Coli
• Protein Sequence: MRGSHHHHHHFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
• Purity: Greater than 90.0% as determined by SDS-PAGE.

Storage & Handling

• Storage: Stability: Ag85B although stable room temperature for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Form/Appearance: Sterile Filtered and lyophilized, though might appear as a solution as a result of the glycerol content.
• Buffer/Preservatives: Lyophilized with no additives.
• Disclaimer: For research use only

Alternative Names

Antigen 85-B, 85B, Extracellular alpha-antigen, Antigen 85 complex B, Ag85B, Mycolyl transferase 85B, EC 2.3.1.-, Fibronectin-binding protein B, 30 kDa extracellular protein, fbpB, A85B, Major Secretory Protein Antigen 85B.