You have no items in your shopping cart.
Ag85B Protein
SKU: orb80904
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Protein Sequence | MRGSHHHHHHFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG |
| Purity | Greater than 90.0% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Ag85B although stable room temperature for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered and lyophilized, though might appear as a solution as a result of the glycerol content. |
| Buffer/Preservatives | Lyophilized with no additives. |
| Disclaimer | For research use only |
Alternative Names
−Antigen 85-B, 85B, Extracellular alpha-antigen, Antigen 85 complex B, Ag85B, Mycolyl transferase 85B, EC 2.3.1.-, Fibronectin-binding protein B, 30 kDa extracellular protein, fbpB, A85B, Major Secretory Protein Antigen 85B.
Similar Products
−FbpB Rabbit Polyclonal Antibody [orb1739]
ELISA
Bacteria
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlRecombinant Mycobacterium bovis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB) [orb2658761]
Greater than 95% as determined by SDS-PAGE.
37.5 kDa
E.coli
100 μg, 1 mg, 20 μgRecombinant Mycobacterium bovis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB) [orb2658720]
Greater than 95% as determined by SDS-PAGE.
38.1 kDa
E.coli
100 μg, 1 mg, 20 μgRecombinant M.tuberculosis fbpB protein [orb1516857]
>95% as determined by SDS-PAGE
34 kDa
100 μg, 500 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Ag85B Protein (orb80904)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



