Aff1 Peptide - N-terminal region

• Catalog Number: orb2011874
• Category: Proteins
• Description: Aff1 Peptide - N-terminal region
• Predicted Reactivity: Mouse
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Protein Sequence: MAAHSSLYNEDRNLLRIREKERRNQEAHQEKEAFPEKAPLFPEPYKTAKG
• MW: 132kDa
• Tested applications: WB
• Application notes: This is a synthetic peptide designed for use in combination with Aff1 Rabbit Polyclonal Antibody (orb574020). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
• Alternative names: 9630032B01Rik, AW319193, Af4, Mllt2h, Rob
• Note: For research use only
• NCBI: NP_598680
• Expiration Date: 6 months from date of receipt.