You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| Target | others |
|---|---|
| CAS Number | 154765-05-6 |
| MW | 4533.17 |
| Purity | ≥95% |
| Formula | C200H308N58O59S2 |
| Protein Sequence | SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: Cys4-Cys9) |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−Adrenomedullin (AM) (13-52), human [orb1679483]
98.51% (May vary between batches)
4533.10
1 mg, 5 mg, 10 mg, 25 mg, 50 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
others
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
