Cart summary

You have no items in your shopping cart.

Adrenomedullin (1-52) Peptide

SKU: orb72286

Description

This product is Adrenomedullin (1-52) Peptide. Its protein sequence is YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 16-21 S=S. Purification is performed using HPLC.

Images & Validation

Key Properties

Protein SequenceYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 16-21 S=S
PurificationHPLC

Storage & Handling

StorageShipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.
Form/AppearanceLyophilized
DisclaimerFor research use only

Alternative Names

ADM 1-52; AM 1-52.

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Adrenomedullin (1-52) Peptide (orb72286)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 360.00
500 μg
$ 700.00
1 mg
$ 1,110.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry