You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578212 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ADH1A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ADH1A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 40kDa |
Target | ADH1A |
UniProt ID | P07327 |
Protein Sequence | Synthetic peptide located within the following region: NYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVA |
NCBI | NP_000658 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ADH1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 1 ug/ml.
Positive control (+): Human liver (LI), Negative control (-): HeLa (HL), Antibody concentration: 1 ug/ml.
WB Suggested Anti-ADH1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Liver.
WB | |
Human, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |