Cart summary

You have no items in your shopping cart.

ADGRB3 Peptide - C-terminal region

ADGRB3 Peptide - C-terminal region

Catalog Number: orb1998485

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1998485
CategoryProteins
DescriptionADGRB3 Peptide - C-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: FRDIPNTSSMENPAPNKNPWDTFKNPSEYPHYTTINVLDTEAKDALELRP
UniProt IDO60242
MW53 kDa
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesBAI3
NoteFor research use only
NCBINP_001695.1