ADAMTSL1 Rabbit Polyclonal Antibody (FITC)

• Catalog Number: orb2090337
• Category: Antibodies
• Description: ADAMTSL1 Rabbit Polyclonal Antibody (FITC)
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ADAMTSL1
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer.
• Conjugation: FITC
• MW: 57kDa
• UniProt ID: Q8N6G6
• Protein Sequence: Synthetic peptide located within the following region: EDRDGLWDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRNIRYRTCSNV
• NCBI: NP_443098
• Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer.
• Alternative names: C9orf94, PUNCTIN, ADAMTSR1, ADAMTSL-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.