ACVR1C/ALK7 Antibody

• Catalog Number: orb1535738
• Category: Antibodies
• Description: ACVR1C/ALK7 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IHC-P, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-113 of human ACVR1C (NP_660302.2). LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME
• Concentration: 0.67 mg/ml
• Dilution range: IHC (1:100 - 1:200), IHC-P (1:67), WB (1:500 - 1:2000)
• Conjugation: Unconjugated
• Target: ACVR1C / ALK7
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Alternative names: ACVR1C, Activin receptor-like kinase 7, ACTR-IC, A
• Note: For research use only
• Application notes: Further information: The predicted MW is 37kDa/46kDa/49kDa/54kDa, while the observed MW by Western blot was 60kDa.
• Expiration Date: 12 months from date of receipt.

Western blot analysis of extracts of SH-SY5Y cells, using ACVR1C antibody at 1:1000 dilution.