You have no items in your shopping cart.
You have no items in your shopping cart.

| Catalog Number | orb1999356 |
|---|---|
| Category | Proteins |
| Description | ACOT9 Peptide - N-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: AALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTN |
| UniProt ID | Q9Y305 |
| MW | 51 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | ACATE2, CGI-16, MTACT48, MT-ACT48 |
| Note | For research use only |
| NCBI | NP_001028755.2 |
| Expiration Date | 6 months from date of receipt. |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review