Cart summary

You have no items in your shopping cart.

ACKR3 Rabbit Polyclonal Antibody (HRP)

ACKR3 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2093375

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2093375
CategoryAntibodies
DescriptionACKR3 Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human ACKR3
Protein SequenceSynthetic peptide located within the following region: VPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAV
UniProt IDP25106
MW39kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesRDC1, CXCR7, RDC-1, CMKOR1, CXC-R7, CXCR-7, GPR159
NoteFor research use only
NCBIXP_005246155
Expiration Date12 months from date of receipt.
  • ACKR3 Rabbit Polyclonal Antibody (HRP) [orb470247]

    IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Mouse, Porcine, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl