You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330242 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ABHD5 |
| Target | ABHD5 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ABHD5 |
| Protein Sequence | Synthetic peptide located within the following region: SVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQK |
| UniProt ID | Q8WTS1 |
| MW | 38kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti CDS antibody, anti CGI58 antibody, anti IECN2 Read more... |
| Research Area | Stem Cell & Developmental Biology |
| Note | For research use only |
| NCBI | NP_057090 |

Human Colon

WB Suggested Anti-ABHD5 Antibody Titration: 0.2-1 ug/mL, Positive Control: MCF7 cell lysate, ABHD5 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Human, Mouse, Rabbit, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Human, Mouse, Rabbit, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
PE |
IHC-Fr, IHC-P | |
Bovine, Canine, Human, Mouse, Rabbit, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
HRP |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review