You have no items in your shopping cart.
Cart summary
AASS Peptide - middle region
Catalog Number: orb2000242
| Catalog Number | orb2000242 |
|---|---|
| Category | Proteins |
| Description | AASS Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| MW | 80 kDa |
| UniProt ID | F8WAH1 |
| Protein Sequence | Synthetic peptide located within the following region: KHPERYISRFNTDIAPYTTCLINGIYWEQNTPRLLTRQDAQSLLAPGKFS |
| NCBI | NP_005754.2 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | LKRSDH, LORSDH, LKR/SDH Read more... |
| Note | For research use only |
| Application notes | This is a synthetic peptide designed for use in combination with AASS Rabbit Polyclonal Antibody (orb589670). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Expiration Date | 6 months from date of receipt. |
