You have no items in your shopping cart.
Cart summary
AAAS Peptide - N-terminal region
Catalog Number: orb2002960
| Catalog Number | orb2002960 |
|---|---|
| Category | Proteins |
| Description | AAAS Peptide - N-terminal region |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| MW | 60kDa |
| UniProt ID | Q9NRG9 |
| Protein Sequence | Synthetic peptide located within the following region: EHNNELVTGSSYESPPPDFRGQWINLPVLQLTKDPLKTPGRLDHGTRTAF |
| NCBI | NP_056480 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | AAAS,ADRACALA,GL003, Read more... |
| Note | For research use only |
| Application notes | This is a synthetic peptide designed for use in combination with AAAS Rabbit Polyclonal Antibody (orb587895). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Expiration Date | 6 months from date of receipt. |
