You have no items in your shopping cart.
Cart summary
Item 1 of 1
Aβ1-40 Peptide
Catalog Number: orb86006
Product Properties
| Catalog Number | orb86006 |
|---|---|
| Category | Proteins |
| Description | This product is Aβ1-40 Peptide. Its protein sequence is DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV. It targets Amyloid-beta precursor protein. Purification is performed using HPLC. |
| Target | Amyloid-beta precursor protein |
| Purification | HPLC |
| Protein Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Storage | Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles. |
| Alternative names | β-Amyloid 1-40; beta Amyloid(1-40); beta-Amyloid 1 Read more... |
| Research Area | DNA / RNA Binding, DNA and RNA Research, RNA Proce Read more... |
| Note | For research use only |
Images
The purity of the protein is greater than 90% as determined by reducing SDS-PAGE.
Similar Products
Rat amyloid beta peptide 1-40,Aβ ELISA Kit [orb410689]
Rat
0.625 pg/mL-40 pg/mL
0.156 pg/mL
24 T, 10 x 96 T, 5 x 96 T, 48 T, 96 THuman amyloid beta peptide 1-40 ELISA Kit [orb405915]
Human
125 pg/mL-8000 pg/mL
31.25 pg/mL
48 T, 24 T, 96 T, 10 x 96 T, 5 x 96 TMouse Aβ1-40 ELISA Kit [orb408896]
Mouse
31.25 pg/mL-2000 pg/mL
7.8 pg/mL
10 x 96 T, 5 x 96 T, 48 T, 96 T, 24 T
Mouse Amyloid Beta Peptide 1-40 (Aβ1-40) ELISA Kit [orb2812601]
Mouse
15.62-1000pg/mL
3.38pg/mL
5 x 96 T, 96 T, 48 T
Reviews
Aβ1-40 Peptide (orb86006)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review