Aβ1-40 Peptide

SKU: orb86006

Description

This product is Aβ1-40 Peptide. Its protein sequence is DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV. It targets Amyloid-beta precursor protein. Purification is performed using HPLC.

Research Area

DNA / RNA Binding, DNA and RNA Research, RNA Processing

Key Properties

• Target: Amyloid-beta precursor protein
• Protein Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
• Purification: HPLC

Storage & Handling

• Storage: Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles.
• Form/Appearance: Lyophilized
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

β-Amyloid 1-40; beta Amyloid(1-40); beta-Amyloid 1-40; beta-Amyloid 1-40; Amyloid 1-40; A4; AAA; ABETA; ABPP; AD1; Alzheimers Disease Amyloid Protein; Amyloid B; Amyloid Beta A4 Protein Precursor; Amyloid Beta; Amyloid of Aging and Alzheimer Disease; APP; APPI; B Amyloid; Beta APP; Cerebral Vascular Amyloid Peptide; CTFgamma; CVAP; PN II; PN2; PreA4; Protease nexin II; A beta; A4_HUMAN.

The purity of the protein is greater than 90% as determined by reducing SDS-PAGE.

Quick Database Links

Gene Symbol

Amyloid-beta precursor protein