You have no items in your shopping cart.
Description
Research Area
DNA / RNA Binding, DNA and RNA Research, RNA Processing
Images & Validation
−Item 1 of 1
Key Properties
−| Target | Amyloid-beta precursor protein |
|---|---|
| Purification | HPLC |
| Protein Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Storage & Handling
−| Storage | Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−β-Amyloid 1-40; beta Amyloid(1-40); beta-Amyloid 1-40; beta-Amyloid 1-40; Amyloid 1-40; A4; AAA; ABETA; ABPP; AD1; Alzheimers Disease Amyloid Protein; Amyloid B; Amyloid Beta A4 Protein Precursor; Amyloid Beta; Amyloid of Aging and Alzheimer Disease; APP; APPI; B Amyloid; Beta APP; Cerebral Vascular Amyloid Peptide; CTFgamma; CVAP; PN II; PN2; PreA4; Protease nexin II; A beta; A4_HUMAN.
Similar Products
−
Rat amyloid beta peptide 1-40,Aβ ELISA Kit [orb410689]
Rat
0.625 pg/mL-40 pg/mL
0.156 pg/mL
48 T, 96 T, 5 x 96 T, 10 x 96 T, 24 THuman amyloid beta peptide 1-40 ELISA Kit [orb405915]
Human
125 pg/mL-8000 pg/mL
31.25 pg/mL
48 T, 96 T, 5 x 96 T, 10 x 96 T, 24 TMouse Aβ1-40 ELISA Kit [orb408896]
Mouse
31.25 pg/mL-2000 pg/mL
7.8 pg/mL
48 T, 96 T, 5 x 96 T, 10 x 96 T, 24 T
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
The purity of the protein is greater than 90% as determined by reducing SDS-PAGE.
Quick Database Links
Gene Symbol
Amyloid-beta precursor protein
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Aβ1-40 Peptide (orb86006)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks.