You have no items in your shopping cart.
Description
Research Area
DNA / RNA Binding, DNA and RNA Research, RNA Processing
Images & Validation
−
Item 1 of 1
Key Properties
−| Target | Amyloid-beta precursor protein |
|---|---|
| Purification | HPLC |
| Protein Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Storage & Handling
−| Storage | Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−β-Amyloid 1-40; beta Amyloid(1-40); beta-Amyloid 1-40; beta-Amyloid 1-40; Amyloid 1-40; A4; AAA; ABETA; ABPP; AD1; Alzheimers Disease Amyloid Protein; Amyloid B; Amyloid Beta A4 Protein Precursor; Amyloid Beta; Amyloid of Aging and Alzheimer Disease; APP; APPI; B Amyloid; Beta APP; Cerebral Vascular Amyloid Peptide; CTFgamma; CVAP; PN II; PN2; PreA4; Protease nexin II; A beta; A4_HUMAN.
Similar Products
−
Human amyloid beta peptide 1-40 ELISA Kit [orb405915]
Human
125 pg/mL-8000 pg/mL
31.25 pg/mL
48 T, 96 T, 5 x 96 T, 10 x 96 T, 24 T
Mouse Amyloid Beta Peptide 1-40 (Aβ1-40) ELISA Kit [orb2812601]
Mouse
15.62-1000pg/mL
3.38pg/mL
48 T, 96 T, 5 x 96 TRat Amyloid Beta Peptide 1-40 (Aβ1-40) ELISA Kit [orb2812612]
Rat
15.62-1000pg/mL
4.62pg/mL
48 T, 96 T, 5 x 96 T
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
Amyloid-beta precursor protein
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks.