You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb763197 |
---|---|
Category | Antibodies |
Description | Rab11A Antibody (monoclonal, 4H9) |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 4H9 |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Mouse IgG2b |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 22 kDa |
UniProt ID | P62491 |
Sensitivity | > 5000 cells |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | Keratin, type II cytoskeletal 8; Cytokeratin-8; CK Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of Rab11A using anti-Rab11A antibody (orb763197). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions. Lane 1: human HeLa whole cell lysates, Lane 2: human placenta tissue lysates, Lane 3: human Colo320 lysates, Lane 4: human MDA-MB453 whole cell lysates, Lane 5: rat testis tissue lysates, Lane 6: rat brain tissue lysates, Lane 7: mouse testis tissue lysates, Lane 8: mouse brain tissue lysates. After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-Rab11A antigen affinity purified monoclonal antibody (Catalog # orb763197) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # orb90502) with Tanon 5200 system. A specific band was detected for Rab11A at approximately 22 kDa. The expected band size for Rab11A is at 22 kDa.
IHC analysis of Rab11A using anti-Rab11A antibody (orb763197). Rab11A was detected in a paraffin-embedded section of human spleen tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml mouse anti-Rab11A Antibody (orb763197) overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90443) with DAB as the chromogen.
IHC analysis of Rab11A using anti-Rab11A antibody (orb763197). Rab11A was detected in a paraffin-embedded section of human gastric carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml mouse anti-Rab11A Antibody (orb763197) overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90443) with DAB as the chromogen.
IHC analysis of Rab11A using anti-Rab11A antibody (orb763197). Rab11A was detected in a paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml mouse anti-Rab11A Antibody (orb763197) overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90443) with DAB as the chromogen.
IF analysis of Rab11A using anti-Rab11A antibody (orb763197). Rab11A was detected in an immunocytochemical section of T-47D cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (orb90553) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 μg/mL mouse anti-Rab11A Antibody (orb763197) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Flow Cytometry analysis of ANA-1 cells using anti-Rab11A antibody (orb763197). Overlay histogram showing ANA-1 cells stained with orb763197 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Rab11A Antibody (orb763197, 1 μg/1x10^6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (5-10 μg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1 μg/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of RH35 cells using anti-Rab11A antibody (orb763197). Overlay histogram showing RH35 cells stained with orb763197 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Rab11A Antibody (orb763197, 1 μg/1x10^6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (5-10 μg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1 μg/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of U937 cells using anti-Rab11A antibody (orb763197). Overlay histogram showing U937 cells stained with orb763197 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Rab11A Antibody (orb763197, 1 μg/1x10^6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (5-10 μg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1 μg/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating