
  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $28.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name PITX2 antibody
Catalog Number orb570403
ReactivityHuman, Mouse
Tested applicationsFACS, WB
Immunogen A synthetic peptide corresponding to a sequence of human PITX2/RGS (METNCRKLVSACVQLGVQPAAVECLFSKDSEIKK).
Target PITX2
Product Properties
Form/Appearance Lyophilized: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Storage Store at 4°C. Upon delivery aliquot and store at -20°C for one year. Avoid freeze/thaw cycles.
Note For research use only.
Reconstitution Add 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Isotype IgG
Purity Immunogen affinity purified.
Uniprot ID Q99697
Entrez 5308
Product Description

Rabbit polyclonal antibody to PITX2

Application Notes
Dilution Range WB: 0.25-0.5 μg/ml, FACS: 1-3 μg/1x106 cells
Write Your Own Review
You're reviewing:PITX2 antibody - orb570403
Your Rating