Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PPARGC1A Rabbit Polyclonal Antibody

SKU: orb330034

Description

Rabbit polyclonal antibody to PPARGC1A

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Molecular Biology, Protein Biochemistry, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PPARGC1A
TargetPPARGC1A
Protein SequenceSynthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS
Molecular Weight91 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti LEM6 antibody, anti PGC-1(alpha) antibody, anti PGC-1v antibody, anti PGC1 antibody, anti PGC1A antibody, anti PPARGC1 antibody

Similar Products

  • PGC1 alpha + beta Rabbit Polyclonal Antibody [orb100963]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Mouse, Porcine, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • PPARGC1A Rabbit Polyclonal Antibody [orb317701]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Goat, Mouse, Porcine, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PPARGC1A Rabbit Polyclonal Antibody [orb1974626]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Goat, Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PPARGC1A Rabbit Polyclonal Antibody [orb329608]

    ICC,  IF,  WB

    Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • PGC1 alpha Rabbit Polyclonal Antibody [orb13647]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PPARGC1A Rabbit Polyclonal Antibody

25 ug of the indicated Mouse whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/mL.

PPARGC1A Rabbit Polyclonal Antibody

Lanes: Lane 1: 30 ug Human liver, Lane 2: 30 ug Rat liver, Lane 3: 30 ug Mouse (wild-type) liver, Lane 4: 30 ug Mouse [AMPK alpha 1/2(-/-)] liver, Lane 5: 30 ug Human muscle, Lane 6: 30 ug Rat muscle, Lane 7: 30 ug Mouse muscle, Primary Antibody Dilution: 1:1000, Secondary Antibody Dilution: 1:10000, Gene Name: PPARGC1A.

PPARGC1A Rabbit Polyclonal Antibody

PPARGC1A antibody - N-terminal region (orb330034) validated by WB using Transfected Melanoma Cell at 1:1000.

PPARGC1A Rabbit Polyclonal Antibody

PPARGC1A antibody - N-terminal region (orb330034) validated by WB using transfected SH-SY5Y lysate at 1:15000.

PPARGC1A Rabbit Polyclonal Antibody

WB Suggested Anti-PPARGC1A Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: ACHN cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_037393

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PPARGC1A Rabbit Polyclonal Antibody (orb330034)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry