You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329608 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PPARGC1A |
Target | PPARGC1A |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PPARGC1A |
Protein Sequence | Synthetic peptide located within the following region: PSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQL |
UniProt ID | Q9UBK2 |
MW | 91kDa |
Tested applications | ICC, IF, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti LEM6 antibody, anti PGC-1(alpha) antibody, an Read more... |
Note | For research use only |
NCBI | NP_037393 |
Sample Tissue: Human 786-0, Antibody Dilution: 1.0 ug/mL.
Sample Type: Mouse retina, Primary Antibody Dilution: 1:200, Secondary Antibody: Donkey anti rabbit-Cy3, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Red: PPARGC1A, Gene Name: PPARGC1A.
WB Suggested Anti-PPARGC1A Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC-Fr, IHC-P, WB | |
Goat, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC-Fr, IHC-P, WB | |
Goat, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |