CFLAR Rabbit Polyclonal Antibody

• Catalog Number: orb592646
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CFLAR
• Target: CFLAR
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CFLAR
• Protein Sequence: Synthetic peptide located within the following region: HQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLA
• UniProt ID: O15519
• MW: 55kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CASH, FLIP, MRIT, CLARP, FLAME, cFLIP, Casper, FLA
• Research Area: Immunology & Inflammation
• Note: For research use only
• NCBI: NP_003870

Sample Tissue: Human HepG2, Antibody Dilution: 1.0 ug/ml.

Lanes: Lane 1: 10 ug hFLIPL transfected 293 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:2000, Gene Name: CFLAR.

WB Suggested Anti-CFLAR Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate. CFLAR is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.