You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592646 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CFLAR |
Target | CFLAR |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CFLAR |
Protein Sequence | Synthetic peptide located within the following region: HQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLA |
UniProt ID | O15519 |
MW | 55kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CASH, FLIP, MRIT, CLARP, FLAME, cFLIP, Casper, FLA Read more... |
Note | For research use only |
NCBI | NP_003870 |
Sample Tissue: Human HepG2, Antibody Dilution: 1.0 ug/ml.
Lanes: Lane 1: 10 ug hFLIPL transfected 293 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:2000, Gene Name: CFLAR.
WB Suggested Anti-CFLAR Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate. CFLAR is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
IF, IHC-Fr, IHC-P, WB | |
Equine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |