Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human TGFB1 (GST) protein
Catalog Number orb428805
ReactivityHuman
ConjugationUnconjugated
Target TGFB1 (GST)
Product Properties
Form/Appearance Sterile Filtered solution.
The protein solution (500μg/ml) contains 50mM Tris-HCl, pH-7.5 and 10mM L-glutathione (reduced).
Storage Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Note For research use only.
Protein Sequence KWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS.
Purity >80.0% as determined by SDS-PAGE.
Source Escherichia Coli.
Product Description

Recombinant of human TGFB1 (GST) protein

Reviews
Write Your Own Review
You're reviewing:Human TGFB1 (GST) protein - orb428805
Your Rating