You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580118 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZKSCAN1 |
Target | ZKSCAN1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A purified |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZKSCAN1 |
Protein Sequence | Synthetic peptide located within the following region: NTKEQILELLVLEQFLSILPKELQVWLQEYRPDSGEEAVTLLEDLELDLS |
UniProt ID | P17029 |
MW | 63kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | KOX18, ZNF36, PHZ-37, ZNF139, ZSCAN33 |
Research Area | Epigenetics & Chromatin |
Note | For research use only |
NCBI | NP_003430 |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-ZKSCAN1 Antibody Titration: 5.0 ug/ml, Positive Control: Jurkat cell lysate.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |