You have no items in your shopping cart.
Cart summary
SETMAR Peptide - middle region
Catalog Number: orb1999447
| Catalog Number | orb1999447 |
|---|---|
| Category | Proteins |
| Description | SETMAR Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: VDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELS |
| UniProt ID | Q53H47 |
| MW | 41 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | Mar1, HsMar1, METNASE |
| Note | For research use only |
| NCBI | NP_001230652.1 |
| Expiration Date | 6 months from date of receipt. |
