You have no items in your shopping cart.
Cart summary
RFC2 Peptide - middle region
Catalog Number: orb1998917
| Catalog Number | orb1998917 |
|---|---|
| Category | Proteins |
| Description | RFC2 Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: KDAMLELNASNDRGIDVVRNKIKMFAQQKVTLPKGRHKIIILDEADSMTD |
| UniProt ID | P35250 |
| MW | 38 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | RFC40 |
| Note | For research use only |
| NCBI | NP_001265720.1 |
