Cart summary

You have no items in your shopping cart.

Recombinant Xenopus laevis paqr8.L&abhd2.S Heterodimer Protein-VLPs

SKU: orb2658174
FeaturedFeatured Product

Description

This Recombinant Xenopus laevis paqr8.L&abhd2.S Heterodimer Protein-VLPs spans the amino acid sequence from region 1-353aa&1-426aa. Purity: The purity information is not available for VLPs proteins.

Images & Validation

Application Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Key Properties

SourceMammalian cell
Biological OriginXenopus laevis (African clawed frog)
TagC-terminal 6xHis-tagged(This tag can be tested only under denaturing conditions)
Molecular Weight41.9kDa
Expression Region1-353aa&1-426aa
Protein LengthHeterodimer
Protein SequenceMTTAILECISTLSISFQQLRRLPRFLEGGTTKMPLTVTDSDVPRLFREPYIQTGYRPTDQDWKYYFLSLFKKHNESVNVWTHLLVALAVVLRVVAFVEAGSLSLNVVSFPLYLYVLSSLTYLTCSILAHLLQSKSELAHYTFYFIDYVGVSTYQYGCALAHYYYTSNEAWYDKACYFFLPGAAFLGWLSCVGCCYAKYCYKRPYPVMRKILQVVPAGLAYILDISPVVHRIVTCHMEDYTDKAVWLHSLQMIFFIIGAYFFSCPVPEKYFPGSCDFIGHGHQIFHVFLGLCTLSQLEALFIDYQTRQEVFSARYSSNYTLMCCASFFLLILCSTFTAVYARRRIKEKLARKEL&MDAIVETPEMPAVFDGMKLAAVAAFLYIIVRSLNLKNPTAPPDLLYQDTALTRYLIKSCPLLTKEYIPPIIWGKSGHIQTALYGKMGRVSSPHPYGLRKYLTMPDGATATFDLFEPLAEHCTGENVTMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALTNIELTSPRMFTYGCTWEFGAMVNYIRKAFPQTQLIVVGFSLGGNIVCKYLGETASNQERVMCCVSVCQGYSASHAQDTFLQWDQLRRVYNFLMADNMKKIILSHRHILFGDGSKANRVLEDTDLSRLYTATSLMQIDDVVMRKFHGYKTVQEYYEAESCIRYLHNIHVPLMLVNSVDDPLVHDSLLTIPKTLAEKKENVLVVLPLHGGHLGFFEGAVLFPEPLTWMDKLIVQYSNAICQWERNKPQCSDVKQAAESDHK
PurityThe purity information is not available for VLPs proteins.

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
DisclaimerFor research use only
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Recombinant Xenopus laevis paqr8.L&abhd2.S Heterodimer Protein-VLPs

Detected by Mouse anti-6*His monoclonal antibody.

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Recombinant Xenopus laevis paqr8.L&abhd2.S Heterodimer Protein-VLPs (orb2658174)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

20 μg
$ 650.00
100 μg
$ 1,220.00
1 mg
$ 6,150.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry