Recombinant Xenopus laevis paqr8.L&abhd2.S Heterodimer Protein-VLPs

SKU: orb2658174

Description

This Recombinant Xenopus laevis paqr8.L&abhd2.S Heterodimer Protein-VLPs spans the amino acid sequence from region 1-353aa&1-426aa. Purity: The purity information is not available for VLPs proteins.

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Key Properties

• Source: Mammalian cell
• Biological Origin: Xenopus laevis (African clawed frog)
• Tag: C-terminal 6xHis-tagged(This tag can be tested only under denaturing conditions)
• Molecular Weight: 41.9kDa
• Expression Region: 1-353aa&1-426aa
• Protein Length: Heterodimer
• Protein Sequence: MTTAILECISTLSISFQQLRRLPRFLEGGTTKMPLTVTDSDVPRLFREPYIQTGYRPTDQDWKYYFLSLFKKHNESVNVWTHLLVALAVVLRVVAFVEAGSLSLNVVSFPLYLYVLSSLTYLTCSILAHLLQSKSELAHYTFYFIDYVGVSTYQYGCALAHYYYTSNEAWYDKACYFFLPGAAFLGWLSCVGCCYAKYCYKRPYPVMRKILQVVPAGLAYILDISPVVHRIVTCHMEDYTDKAVWLHSLQMIFFIIGAYFFSCPVPEKYFPGSCDFIGHGHQIFHVFLGLCTLSQLEALFIDYQTRQEVFSARYSSNYTLMCCASFFLLILCSTFTAVYARRRIKEKLARKEL&MDAIVETPEMPAVFDGMKLAAVAAFLYIIVRSLNLKNPTAPPDLLYQDTALTRYLIKSCPLLTKEYIPPIIWGKSGHIQTALYGKMGRVSSPHPYGLRKYLTMPDGATATFDLFEPLAEHCTGENVTMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALTNIELTSPRMFTYGCTWEFGAMVNYIRKAFPQTQLIVVGFSLGGNIVCKYLGETASNQERVMCCVSVCQGYSASHAQDTFLQWDQLRRVYNFLMADNMKKIILSHRHILFGDGSKANRVLEDTDLSRLYTATSLMQIDDVVMRKFHGYKTVQEYYEAESCIRYLHNIHVPLMLVNSVDDPLVHDSLLTIPKTLAEKKENVLVVLPLHGGHLGFFEGAVLFPEPLTWMDKLIVQYSNAICQWERNKPQCSDVKQAAESDHK
• Purity: The purity information is not available for VLPs proteins.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
• Disclaimer: For research use only

Detected by Mouse anti-6*His monoclonal antibody.

Quick Database Links

UniProt

A0A1L8GSQ0, Q801G4