Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Recombinant Xenopus laevis paqr8.L&abhd2.S Heterodimer Protein-VLPs

SKU: orb2658174

Description

This Recombinant Xenopus laevis paqr8.L&abhd2.S Heterodimer Protein-VLPs spans the amino acid sequence from region 1-353aa&1-426aa. Purity: The purity information is not available for VLPs proteins.

Research Area

Metabolism Research; Stem Cell & Developmental Biology

Images & Validation

Application Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Key Properties

SourceMammalian cell
Biological OriginXenopus laevis (African clawed frog)
TagC-terminal 6xHis-tagged (This tag can be tested only under denaturing conditions)
Expression Region1-353aa&1-426aa
Protein LengthHeterodimer
MW41.9 kDa
PurityThe purity information is not available for VLPs proteins.
Protein SequenceMTTAILECISTLSISFQQLRRLPRFLEGGTTKMPLTVTDSDVPRLFREPYIQTGYRPTDQDWKYYFLSLFKKHNESVNVWTHLLVALAVVLRVVAFVEAGSLSLNVVSFPLYLYVLSSLTYLTCSILAHLLQSKSELAHYTFYFIDYVGVSTYQYGCALAHYYYTSNEAWYDKACYFFLPGAAFLGWLSCVGCCYAKYCYKRPYPVMRKILQVVPAGLAYILDISPVVHRIVTCHMEDYTDKAVWLHSLQMIFFIIGAYFFSCPVPEKYFPGSCDFIGHGHQIFHVFLGLCTLSQLEALFIDYQTRQEVFSARYSSNYTLMCCASFFLLILCSTFTAVYARRRIKEKLARKEL&MDAIVETPEMPAVFDGMKLAAVAAFLYIIVRSLNLKNPTAPPDLLYQDTALTRYLIKSCPLLTKEYIPPIIWGKSGHIQTALYGKMGRVSSPHPYGLRKYLTMPDGATATFDLFEPLAEHCTGENVTMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALTNIELTSPRMFTYGCTWEFGAMVNYIRKAFPQTQLIVVGFSLGGNIVCKYLGETASNQERVMCCVSVCQGYSASHAQDTFLQWDQLRRVYNFLMADNMKKIILSHRHILFGDGSKANRVLEDTDLSRLYTATSLMQIDDVVMRKFHGYKTVQEYYEAESCIRYLHNIHVPLMLVNSVDDPLVHDSLLTIPKTLAEKKENVLVVLPLHGGHLGFFEGAVLFPEPLTWMDKLIVQYSNAICQWERNKPQCSDVKQAAESDHK

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

20 μg
$ 700.00
100 μg
$ 1,360.00
1 mg
$ 6,990.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry