Recombinant Mouse Atrial natriuretic peptide receptor 1 (Npr1), partial

SKU: orb2658704

Description

This Recombinant Mouse Atrial natriuretic peptide receptor 1 (Npr1), partial spans the amino acid sequence from region 29-469aa. Purity: Greater than 90% as determined by SDS-PAGE.

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: Mammalian cell
• Biological Origin: Mus musculus (Mouse)
• Tag: C-terminal 10xHis-tagged
• Molecular Weight: 50.7 kDa
• Expression Region: 29-469aa
• Protein Length: Partial
• Protein Sequence: SDLTVAVVLPLTNTSYPWSWARVGPAVELALGRVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQEFVEGDPDHYTKLLRTVQRKGRVIYICSSPDAFRNLMLLALDAGLTGEDYVFFHLDVFGQSLQGAQGPVPRKPWERDDGQDRRARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTMEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNFNGTSQELMAVSEHRLYWPLGYPPPDIPKCGFDNEDPACNQDHFSTLE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
• Disclaimer: For research use only

Alternative Names

Atrial natriuretic peptide receptor 1; EC:4.6.1.2；Atrial natriuretic peptide receptor type A (ANP-A; ANPR-A; NPR-A); Guanylate cyclase A (GC-A)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P18293