You have no items in your shopping cart.
Recombinant Dog Copper transport protein ATOX1 (ATOX1)
SKU: orb2658071
Featured
Description
Research Area
Cell Biology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Canis lupus familiaris (Dog) (Canis familiaris) |
| Tag | C-terminal 6xHis-tagged |
| Molecular Weight | 14.3 kDa |
| Expression Region | 1-68aa |
| Protein Length | Full Length |
| Protein Sequence | MPKHEFSVDMTCEGCSNAVSRVLNKLGGVEFDIDLPNKKVCINSEHSVDILLETLEKTGKAVSYLGPK |
| Purity | Greater than 95% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−Metal transport protein ATX1

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Dog Copper transport protein ATOX1 (ATOX1) (orb2658071)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review