Cart summary

You have no items in your shopping cart.

PPARGC1A Peptide - middle region

PPARGC1A Peptide - middle region

Catalog Number: orb1997971

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1997971
CategoryProteins
DescriptionPPARGC1A Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: ALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNE
UniProt IDQ9UBK2
MW31 kDa
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesLEM6, PGC1, PGC1A, PGC-1v, PPARGC1, PGC-1alpha, PG
Read more...
NoteFor research use only
NCBINP_001317680.1
Expiration Date6 months from date of receipt.