You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1997971 |
---|---|
Category | Proteins |
Description | PPARGC1A Peptide - middle region |
Predicted Reactivity | Human |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized powder |
Protein Sequence | Synthetic peptide located within the following region: ALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNE |
UniProt ID | Q9UBK2 |
MW | 31 kDa |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Alternative names | LEM6, PGC1, PGC1A, PGC-1v, PPARGC1, PGC-1alpha, PG Read more... |
Note | For research use only |
NCBI | NP_001317680.1 |
Expiration Date | 6 months from date of receipt. |