You have no items in your shopping cart.
Cart summary
MAPRE3 Peptide - middle region
Catalog Number: orb2001436
| Catalog Number | orb2001436 |
|---|---|
| Category | Proteins |
| Description | MAPRE3 Peptide - middle region |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| MW | 32 kDa |
| UniProt ID | Q9UPY8 |
| Protein Sequence | Synthetic peptide located within the following region: SKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHET |
| NCBI | NP_001289979.1 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | EB3, RP3, EBF3, EBF3-S Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
