You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325135 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TYRP1 |
Target | TYRP1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Porcine, Rabbit, Rat, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TYRP1 |
Protein Sequence | Synthetic peptide located within the following region: AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTF |
UniProt ID | P17643 |
MW | 59kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti CAS2 antibody, anti CATB antibody, anti GP75 Read more... |
Note | For research use only |
NCBI | NP_000541 |
Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.
WB Suggested Anti-TYRP1 Antibody Titration: 2.5 ug/mL, Positive Control: Jurkat cell lysate.
IHC, WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Sheep, Zebrafish | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Equine, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Cy3 |