You have no items in your shopping cart.
tdTomato Antibody
Description
Customer Validated Data
−Success by Application
Reactivity Distribution
Latest Experiments
1 ResultsImages & Validation
−| Tested Applications | ELISA, FACS, IF, IHC-Fr, IHC-P, WB |
|---|---|
| Dilution range | WB 1:500-1:2,000 IHC (F) 1:50-1:500 IHC (P) 1:50-1:500 IF 1:50-1:500 |
| Reactivity | Other |
| Application Notes |
Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Goat |
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Purified recombinant peptide produced in E. coli.. Antigen Sequence: MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK |
| Target | Red Fluorescent Protein |
| Molecular Weight | 55 kDa |
| Purity | This antibody is epitope-affinity purified from goat antiserum |
| Purification | Epitope affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours |
|---|---|
| Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
| Concentration | 1 mg/ml |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Western blot analysis of HEK293 cell line lysate using tdTomato antibody.

Confocal immunofluoroscence analysis of HEK293 cells using tdTomato antibody.
Quick Database Links
Documents Download
Request a Document
Protocol Information
Filter by Applications
Filter by Species
Yang, Yang et al. Derivation of Pluripotent Stem Cells with In Vivo Embryonic and Extraembryonic Potency Cell, 169, 243-257.e25 (2017)
Applications
Reactivity
Mao, Xiying et al. Single-Cell RNA Sequencing of hESC-Derived 3D Retinal Organoids Reveals Novel Genes Regulating RPC Commitment in Early Human Retinogenesis Stem Cell Reports, (2019)
Applications
Reactivity
Li Li # 1 2 3, Yu He # 1 2 3, Kai Liu 4, Lin Liu 1 2 3, Shan Shan 1 2 3, Helin Liu 1 2 3, Jiangbo Ren 1 2 3, Shujie Sun 1 2 3, Min Wang 1 2 3, Jidong Jia 5 6 7, Ping Wang GITRL impairs hepatocyte repopulation by liver progenitor cells to aggravate inflammation and fibrosis by GITR+CD8+ T lymphocytes in CDE Mice Cell Death Dis, 15, 114 (2024)
Applications
Reactivity
Jia Sun #1, Xinyuan Wang #12, Rui Sun 1, Xiaoao Xiao 1, Yu Wang 1, Yu Peng 1, Yuanqing Gao 3 Microglia shape AgRP neuron postnatal development via regulating perineuronal net plasticity Mol Psychiatry, (2023)
Applications
Reactivity
Jian Ge 1, Hongxia Shao 1 2, Hongxu Ding 3, Yuefeng Huang 4, Xuebing Wu 5, Jie Sun 6, Jianwen Que Single Cell Analysis of Lung Lymphatic Endothelial Cells and Lymphatic Responses during Influenza Infection J Respir Biol Transl Med, 1, 10003 (2024)
Applications
Reactivity
Capdevila Castillo, Claudia Identification of a Homeostatic Stem Cell Population in the Intestinal Upper Crypt academiccommons.columbia.edu,
Applications
Jiangying Liu 1, Dan Luo 1, Haidi Huang 1, Rongzi Mu 1, Jianghong Yuan 1, Ming Jiang 2, Chuwen Lin 3, Honggang Xiang 4, Xinhua Lin 5, Haihan Song 6 7, Yongchun Zhang Hippo signaling cooperates with p53 to regulate lung airway mucous cell metaplasia Dis Model Mech, (2024)
Jian He 1, Yangyang Cao 1, Qian Zhu 2, Xinge Wang 1, Guo Cheng 3, Qiang Wang 4, Rukun He 1, Haoran Lu 5, Yuancheng Weng 1, Genxiang Mao 6, Yizhong Bao 6, Jing Wang 7, Xiaoli Liu 8, Fei Han 9, Peng Shi 10, Xiao Z Shen Renal macrophages monitor and remove particles from urine to prevent tubule obstruction Immunity, (2024)
Xiaogang Zhang 1, Jingping Liu 2, Xinyao Li 3, Guilang Zheng 4, Tianci Wang 3, Hengbiao Sun 2, Zhengcong Huang 3, Junyu He 3, Ju Qiu 5, Zhibin Zhao 6, Yuxiong Guo 4, Yumei He Blocking the HIF-1α/glycolysis axis inhibits allergic airway inflammation by reducing ILC2 metabolism and function Allergy, (2024)
Xiangyi Ke 1, Benjamin van Soldt 2, Lukas Vlahos 3, Yizhuo Zhou 4, Jun Qian 5, Joel George 6, Claudia Capdevila 7, Ian Glass 8, Kelley Yan 7, Andrea Califano 9, Wellington V Cardoso Morphogenesis and regeneration share a conserved core transition cell state program that controls lung epithelial cell fate Dev Cell ., (2024)
Siwen Chen # 1 2, Yingxin Lin # 3 4 5, Hao Yang # 6, Zihao Li 1 2, Sifang Li 1 2, Dongying Chen 7, Wenjun Hao 1 2, Shuai Zhang 1 2, Hua Chao 1 2, Jingyu Zhang 1 2, Jianru Wang 1 2, Zemin Li 1 2, Xiang Li 1 2, Zhongping Zhan 7, Hui Liu A CD26+ tendon stem progenitor cell population contributes to tendon repair and heterotopic ossification Nat Commun, (2025)
Applications
Yinshan Fang 1, Sanny S W Chung 1, Le Xu 2, Chenyi Xue 3, Xue Liu 4, Dianhua Jiang 4, Rongbo Li 2, Yohei Korogi 2, Ke Yuan 5, Anjali Saqi 6, Hanina Hibshoosh 6, Yuefeng Huang 7, Chyuan-Sheng Lin 8, Tatsuya Tsukui 9, Dean Sheppard 9, Xin Sun 10, Jianwen Que RUNX2 promotes fibrosis via an alveolar-to-pathological fibroblast transition Nature, (2025)
Applications
Saida Oubraim 1, Kathryn Hausknecht 1, Veronika Micov 1, Roh-Yu Shen 1 2, Samir Haj-Dahmane Chemogenetic inhibition of prefrontal cortex inputs to dorsal raphe reduces anxiety behaviors in male rat model of fetal alcohol spectrum disorder Sci Rep, (2025)
Pomaville, Matthew B. et al. Follicle-innervating A[delta]-low threshold mechanoreceptive neurons form receptive fields through homotypic competition Neural Dev, 18, 2 (2023)
Applications
Reactivity
Fang, Yinshan et al. Epithelial Wntless regulates postnatal alveologenesis Development, 149, dev199505 (2022)
Applications
Reactivity
Li, Hui et al. Identification of novel B-1 transitional progenitors by B-1 lymphocyte fate-mapping transgenic mouse model Bhlhe41 dTomato-Cre Front Immunol, 13, 946202 (2022)
Miller, Daniel S. et al. Neuronal Dystroglycan regulates postnatal development of CCK/cannabinoid receptor-1 interneurons Neural Dev, 16, 4 (2021)
SOX9 Modulates the Transformation of Gastric Stem Cells Through Biased Symmetric Cell Division Gastroenterology, S0016-5085(23)00109-9 (2023)
Therapeutic resistance and susceptibility is shaped by cooperative multi-compartment tumor adaptation Cell Death Differ, 26, 2416-2429 (2019)
Yartseva, Valeria et al. Heterogeneity of Satellite Cells Implicates DELTA1/NOTCH2 Signaling in Self-Renewal Cell Rep, 30, 1491-1503.e6 (2020)
Yinshan Fang et al. Lyz1-Expressing Alveolar Type II Cells Contribute to Lung Regeneration Journal of Respiratory Biology and Translational Medicine, (2025)
Applications
Reactivity
LECT2, a Ligand for Tie1, Plays a Crucial Role in Liver Fibrogenesis Cell, 178, 1478-1492.e20 (2019)
Applications
Jiang, Ming et al. VEGF receptor 2 (KDR) protects airways from mucus metaplasia through a Sox9-dependent pathway Dev Cell, 56, 1646-1660.e5 (2021)
Hu, Yanyan et al. Induction of mouse totipotent stem cells by a defined chemical cocktail Nature, (2022)
Lianjie Miao et al. Distinct populations of vascular smooth muscle and sinoatrial progenitors are localized adjacent to pro-epicardium Cell Rep, (2025)
Applications
Reactivity
Jiayu Zhou et al. Fzd2 orchestrates canonical and non-canonical Wnt signaling to regulate lung development and fibrosis Cell Commun Signal, (2025)
Applications
Reactivity
Zhiming Liu et al. Obesity impairs gut repair via AFABP-mediated iron overload in intestinal stem cells Nat Metab, (2026)
Applications
Reactivity
Zhang, Lianghui et al. Single-cell transcriptomic profiling of lung endothelial cells identifies dynamic inflammatory and regenerative subpopulations JCI Insight, 7, e158079 (2022)
He, Jianbo et al. DNA methylation maintenance at the p53 locus initiates biliary-mediated liver regeneration NPJ Regen Med, 7, 21 (2022)
Zhang, Junren et al. Tel2 regulates redifferentiation of bipotential progenitor cells via Hhex during zebrafish liver regeneration Cell Rep, 39, 110596 (2022)
Gribben, Christopher et al. Ductal Ngn3-expressing progenitors contribute to adult β cell neogenesis in the pancreas Cell Stem Cell, (2021)
Gu, Bin et al. Live imaging YAP signalling in mouse embryo development Open Biol, 12, 210335 (2022)
tdTomato Antibody (orb182397)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








