You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb11618 |
---|---|
Category | Antibodies |
Description | Goat polyclonal antibody to mCherry (Cherry fluorescent protein). |
Species/Host | Goat |
Clonality | Polyclonal |
Tested applications | IEM, IF, IHC-Fr, IHC-P, WB |
Reactivity | Other |
Isotype | IgG |
Immunogen | Antigen: Purified recombinant peptide produced in E. coli.. Antigen Sequence: MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK |
Antibody Type | Primary Antibody |
Concentration | 1 mg/ml |
Dilution range | WB:1:500-1:5,000, IF:1:50-1:500, IHC-P:1:50-1:500, IHC-F:1:50-1:500, IEM:1:50-1:500 |
Conjugation | Unconjugated |
Target | Red Fluorescent Protein |
RRID | AB_2687829 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
Alternative names | Cherry fluorescent protein; dsRed, red fluorescent Read more... |
Note | For research use only |
Application notes | The antibody solution should be gently mixed before use. |
Expiration Date | 12 months from date of receipt. |
Filter by Applications
Filter by Reactivity
Bárbara Adem 1 2, Nuno Bastos 1 2, Carolina F Ruivo 1, Sara Sousa-Alves 1, Carolina Dias 1 3, Patrícia F Vieira 1 3, Inês A Batista 1 2, Bruno Cavadas 1, Dieter Saur 4 5, José C Machado 1 6 7, Dawen Cai 8 9 10, Sonia A Melo Exosomes define a local and systemic communication network in healthy pancreas and pancreatic ductal adenocarcinoma Nat Commun, 15, 1496 (2024)
Applications
Reactivity
Olga A Balashova # 1, Alexios A Panoutsopoulos # 2, Olesya Visina 2, Jacob Selhub 3, Paul S Knoepfler 4, Laura N Borodinsky Noncanonical function of folate through folate receptor 1 during neural tube formation Nat Commun, 15(1):, 1642 (2024)
Applications
Reactivity
Allison M Kirk 1, Jeremy Chase Crawford 1, Ching-Heng Chou 1, Cliff Guy 1, Kirti Pandey 2, Tanya Kozlik 3, Ravi K Shah 3, Shanzou Chung 2, Phuong Nguyen 4, Xiaoyu Zhang 5, Jin Wang 6, Matthew Bell 4, Robert C Mettelman 1, E Kaitlynn Allen 1, Mikhail V Pogorelyy 1, Hyunjin Kim 1, Anastasia A Minervina 1, Walid Awad 1, Resha Bajracharya 7, Toni White 5, Donald Long Jr 8, Brittney Gordon 9, Michelle Morrison 10, Evan S Glazer 11, Andrew J Murphy 12, Yixing Jiang 13, Elizabeth A Fitzpatrick 6, Mark Yarchoan 14, Praveen Sethupathy 8, Nathan P Croft 2, Anthony W Purcell 2, Sara M Federico 15, Elizabeth Stewart 16, Stephen Gottschalk 4, Anthony E Zamora 3, Christopher DeRenzo 4, Scott E Strome 17, Paul G Thomas DNAJB1-PRKACA fusion neoantigens elicit rare endogenous T cell responses that potentiate cell therapy for fibrolamellar carcinoma Cell Rep Med, 5, 101469 (2024)
Applications
Reactivity
Ting Zhao # 1, Yan Hong # 1, Bowen Yan 2, Suming Huang 3, Guo-Li Ming 4 5 6 7, Hongjun Song Epigenetic maintenance of adult neural stem cell quiescence in the mouse hippocampus via Setd1a Nat Commun, (2024)
Reactivity
Y Sun, X Wang, DY Zhang, Z Zhang, JP Bhattarai Brain-wide neuronal circuit connectome of human glioblastoma bioRxiv,, (2024)
Jana L Raynor 1, Nicholas Collins 2, Hao Shi 1, Cliff Guy 1, Jordy Saravia 1, Seon Ah Lim 1, Nicole M Chapman 1, Peipei Zhou 1, Yan Wang 1, Yu Sun 1, Isabel Risch 1, Haoran Hu 1, Anil Kc 1, Renqiang Sun 1, Sharad Shrestha 1, Hongling Huang 1, Jon P Connelly 3, Shondra M Pruett-Miller 3, Miguel Reina-Campos 4, Ananda W Goldrath 5, Yasmine Belkaid 2, Hongbo Chi CRISPR screens unveil nutrient-dependent lysosomal and mitochondrial nodes impacting intestinal tissue-resident memory CD8+ T cell formation Immunity, (2024)
Applications
Reactivity
Ye Zhang 1, Wei Duan 1, Lingchao Chen 1, Junrui Chen 1, Wei Xu 1, Qi Fan 1, Shuwei Li 1, Yuandong Liu 2, Shidi Wang 2, Quansheng He 1, Xiaohui Li 1, Yang Huang 1, Haibao Peng 1, Jiaxu Zhao 1, Qiangqiang Zhang 3, Zhixin Qiu 4, Zhicheng Shao 1, Bo Zhang 5, Yihua Wang 1, Yang Tian 6, Yousheng Shu 7, Zhiyong Qin 8, Yudan Chi Potassium ion channel modulation at cancer-neural interface enhances neuronal excitability in epileptogenic glioblastoma multiforme Neuron, (2024)
SRS Alves Bio-Distribution of Pancreas-Derived Exosomes aberto.up.pt, (2024)
Esther C H Uijttewaal 1 2, Joonsun Lee 1 2, Annika Charlotte Sell 1, Naomi Botay 1, Gintautas Vainorius 1 2, Maria Novatchkova 1 3, Juliane Baar 1, Jiaye Yang 1, Tobias Potzler 1, Sophie van der Leij 1, Christopher Lowden 4, Julia Sinner 1, Anais Elewaut 2 3, Milanka Gavrilovic 1, Anna Obenauf 3, Daniel Schramek 4 5, Ulrich Elling CRISPR-StAR enables high-resolution genetic screening in complex in vivo models Nat Biotechnol, (2024)
Applications
Reactivity
Jiaxu Zhao # 1 2 3 4 5, Rui Zeng # 1 2 3 4 5, Xiaohui Li 1 2 3 4 5, Ying Lu 6 7, Zuoyun Wang 8 9, Haibao Peng 1 2 3 4 5, Hao Chen 2 3 4 5, Minjie Fu 1, Ye Zhang 1 2 3 4 5, Yang Huang 1 2 3 4 5, Wenhan Chen 2 3 4 5, Xin Wang 10 11 12 13, Yun Guan 10 11 12 13, Wei Han 1, Ruofan Huang 14, Chengjun Yao 1, Zhiyong Qin 1, Lingchao Chen 1, Liang Chen 1, Xue Feng 15, Hanting Yang 2 16, Patrícia M R Pereira 17, Xuemei Tong 18 19 20, Bin Li 21 22, Qiangqiang Zhang 23 24, Yudan Chi 25 Dura immunity configures leptomeningeal metastasis immunosuppression for cerebrospinal fluid barrier invasion Nat Cancer, (2024)
Applications
Reactivity
Orientadora – Sónia Melo, PhD ExoBow: The Spatiotemporal Biodistribution of Pancreatic Cancer Exosomes repositorio-aberto.up.pt, (2025)
Zongyi Xu 1, Wei Duan 1, Shuyu Yuan 1, Xiaoxue Zhang 1, Chong You 2, Jin-Tai Yu 1, Jian Wang 1, Jia-Da Li 3, Suixin Deng 4, Yousheng Shu Deep brain stimulation alleviates Parkinsonian motor deficits through desynchronizing GABA release in mice Nat Commun, (2025)
Talley MJ, Nardini D, Ehrman LA, Lu QR, Waclaw RR Distinct requirements for Tcf3 and Tcf12 during oligodendrocyte development in the mouse telencephalon Neural Dev., 18(1), 5 (2023)
Zhou, Tian et al. Microglial debris is cleared by astrocytes via C4b-facilitated phagocytosis and degraded via RUBICON-dependent noncanonical autophagy in mice Nat Commun, 13, 6233 (2022)
Huang, Yubin et al. Repopulated microglia are solely derived from the proliferation of residual microglia after acute depletion Nat Neurosci, 21, 530-540 (2018)
Gong, ChenZi et al. Human spinal GABA neurons alleviate spasticity and improve locomotion in rats with spinal cord injury Cell Rep, 34, 108889 (2021)
Jonscher, Ernst et al. Two COWP-like cysteine rich proteins from Eimeria nieschulzi (coccidia, apicomplexa) are expressed during sporulation and involved in the sporocyst wall formation Parasit Vectors, 8, 395 (2015)
Ramesh, Girish et al. A short isoform of STIM1 confers frequency-dependent synaptic enhancement Cell Rep, 34, 108844 (2021)
Li, Fei et al. Murine leukemia virus Gag localizes to the uropod of migrating primary lymphocytes J Virol, 88, 10541-10555 (2014)
Western blot analysis of transfected 293 HEK with mCherry cell lysate using mCherry antibody
Immunohistochemical analysis of mouse mammary tumor cell line using mCherry goat antibody
Confocal immunofluorescence analysis of COS-7 transfected with mCherry-EEA1 using mCherry antibody
ELISA, IF, WB | |
Unconjugated |