Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SOX2 Rabbit Polyclonal Antibody

SKU: orb573909

Description

SOX2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SOX2. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human SOX2. This antibody reacts with Frog, Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Goat, Porcine, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityFrog, Human, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Porcine, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SOX2
TargetSOX2
Protein SequenceSynthetic peptide located within the following region: MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMV
Molecular Weight34kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ANOP3, MCOPS3

Similar Products

  • SOX2 Rabbit Polyclonal Antibody [orb11398]

    IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • SOX2 Rabbit Polyclonal Antibody [orb33646]

    IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • SOX2 Rabbit Polyclonal Antibody [orb500791]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Human, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • SOX2 Rabbit Polyclonal Antibody [orb576582]

    IHC,  WB

    Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SOX2 Antibody (N-term) [orb1931757]

    FC,  IF,  IHC-P,  WB

    Mouse, Other, Sheep, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SOX2 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

SOX2 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

SOX2 Rabbit Polyclonal Antibody

Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.

SOX2 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

SOX2 Rabbit Polyclonal Antibody

Human kidney

SOX2 Rabbit Polyclonal Antibody

Human Spleen

SOX2 Rabbit Polyclonal Antibody

Application:IHC Species+tissue/cell type: Xenopus laevis cornea epithellium Primary antibody dilution: 1:300 Secondary antibody:Goat anti-rabbit -rhodamine Secondary antibody dilution: 1:300.

SOX2 Rabbit Polyclonal Antibody

Sample Type: Lane 1: 20 ug U87 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:2000.

SOX2 Rabbit Polyclonal Antibody

WB Suggested Anti-SOX2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:500, Positive Control: OVCAR-3 cell lysate, There is BioGPS gene expression data showing that SOX2 is expressed in OVCAR3.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003097

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SOX2 Rabbit Polyclonal Antibody (orb573909)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry