S100b Rabbit Polyclonal Antibody

• Catalog Number: orb574858
• Category: Antibodies
• Description: Rabbit polyclonal antibody to S100b
• Target: S100b
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Rat
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: KLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMA
• UniProt ID: P04631
• MW: 11 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: S100P
• Research Area: Neuroscience, Stem Cell & Developmental Biology
• Note: For research use only
• NCBI: NP_037323
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse whole cell or tissue extracts was loaded onto a 10-20% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment.

WB Suggested Anti-S100b Antibody, Titration: 1.0 ug/ml, Positive Control: Rat Brain.