You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse Sigirr protein
Catalog Number: orb383088
| Catalog Number | orb383088 |
|---|---|
| Category | Proteins |
| Description | Recombinant mouse Sigirr protein. |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH |
| Protein Length | Partial |
| UniProt ID | Q9JLZ8 |
| MW | 28.7 kDa |
| Application notes | E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Mus musculus (Mouse) |
| Expression Region | 1-117aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Single Ig IL-1R-related molecule Single immunoglob Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Mouse Sigirr protein [orb383127]
Greater than 90% as determined by SDS-PAGE.
14.7 kDa
Yeast
1 mg, 20 μg, 100 μg 
Recombinant Mouse SIGIRR Protein, N-GST & C-His [orb2831414]
> 90% as determined by SDS-PAGE.
40.72 kDa
100 μg, 50 μg, 20 μgMouse SIGIRR Protein, Fc & His Tag [orb2699408]
> 95%, determined by SDS-PAGE
This protein contains the mouse SIGIRR (NP_0755462) (Met 1-His 117) was fused with the C-terminal polyhistidine-tagged Fc region of human IgG1 at the C-terminus and expressed from HEK293 Cells.
100 μg, 200 μgMouse SIGIRR Protein, Fc Tag [orb2698911]
> 95%, determined by SDS-PAGE
This protein contains the mouse IL1RAPL1 (P59823) extracellular domain (Met 1-Thr 357) was fused with the Fc region of human IgG1 at the C-terminus and expressed from HEK293 Cells.
50 μg, 100 μg
