You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb383127 |
---|---|
Category | Proteins |
Description | Recombinant mouse Sigirr protein. |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH |
Protein Length | Full Length |
UniProt ID | Q9JLZ8 |
MW | 14.7 kDa |
Application notes | E.coli and Yeast N-terminal 6xHis-tagged Full Length |
Endotoxins | Not test. |
Source | Yeast |
Biological Origin | Mus musculus (Mouse) |
Expression Region | 1-117aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Single Ig IL-1R-related molecule Single immunoglob Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 90% as determined by SDS-PAGE. | |
28.7 kDa | |
E.coli |
> 90% as determined by SDS-PAGE. | |
40.72 kDa |
> 95%, determined by SDS-PAGE | |
This protein contains the mouse SIGIRR (NP_0755462) (Met 1-His 117) was fused with the C-terminal polyhistidine-tagged Fc region of human IgG1 at the C-terminus and expressed from HEK293 Cells. |
> 95%, determined by SDS-PAGE | |
This protein contains the mouse IL1RAPL1 (P59823) extracellular domain (Met 1-Thr 357) was fused with the Fc region of human IgG1 at the C-terminus and expressed from HEK293 Cells. |