Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

MMP1 Rabbit Polyclonal Antibody

SKU: orb578315

Description

Rabbit polyclonal antibody to MMP1

Research Area

Disease Biomarkers, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityEquine, Human
Predicted ReactivityAnimal, Human

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MMP1
TargetMMP1
Protein SequenceSynthetic peptide located within the following region: PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF
Molecular Weight54kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CLG, CLGN

Similar Products

  • MMP-1 Rabbit Polyclonal Antibody [orb101432]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • MMP13 Rabbit Polyclonal Antibody [orb11057]

    IF,  IHC-Fr,  IHC-P,  WB

    Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • MMP13 Rabbit Polyclonal Antibody [orb185143]

    IF,  IHC-Fr,  IHC-P,  WB

    Canine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • MMP1 Rabbit Polyclonal Antibody [orb570339]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • MMP1 Rabbit Polyclonal Antibody [orb1294376]

    IF,  IHC,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    25 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

MMP1 Rabbit Polyclonal Antibody

Sample Type: Equine Cartilage Explants, Primary Dilution: 1:800.

MMP1 Rabbit Polyclonal Antibody

Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/ml.

MMP1 Rabbit Polyclonal Antibody

Human Colorectal cancer sample, Human Liver Sample.

MMP1 Rabbit Polyclonal Antibody

MMP1 in epithelial cells ovarian carcinoma was detected using HRP/DAB brown color stain. Antibody Titration: 2-10 ug/ml, Positive Control: Human epithelial cells ovarian carcinoma.

MMP1 Rabbit Polyclonal Antibody

Rabbit Anti-MMP1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

MMP1 Rabbit Polyclonal Antibody

Rabbit Anti-MMP1 Antibody, Paraffin Embedded Tissue: Human Intestine, Cellular Data: Epithelial cells of intestinal villas, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

MMP1 Rabbit Polyclonal Antibody

species sample: Human, cell/tissue: macrophagesHuman macrophages, Dilution: 1/200.

MMP1 Rabbit Polyclonal Antibody

WB Suggested Anti-MMP1 Antibody, Positive Control: Lane 1: 15 ug HT29 cell lysate. Lane 2: 15 ug HT29 cell lysate. Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:2000.

MMP1 Rabbit Polyclonal Antibody

WB Suggested Anti-MMP1 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002412

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

MMP1 Rabbit Polyclonal Antibody (orb578315)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 530.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry