Cart summary

You have no items in your shopping cart.

LDHA Rabbit Polyclonal Antibody

SKU: orb582474

Description

Rabbit polyclonal antibody to LDHA

Research Area

Epigenetics

Images & Validation

Tested ApplicationsIHC-P, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human LDHA
TargetLDHA
Protein SequenceSynthetic peptide located within the following region: PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH
Molecular Weight37kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

LDHM, GSD11, PIG19, HEL-S-133P

Similar Products

  • LDHA Rabbit Polyclonal Antibody [orb381077]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • LDHA Rabbit Polyclonal Antibody [orb582473]

    IHC,  WB

    Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • LDHA Rabbit Polyclonal Antibody [orb13539]

    ELISA,  IF,  IHC-Fr,  IHC-P

    Bovine, Human, Porcine, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • LDHA Specific Rabbit Polyclonal Antibody [orb395266]

    ELISA,  FC,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • LDHA Rabbit Polyclonal Antibody [orb628406]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

LDHA Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat, MCF7, 721_B, Antibody dilution: 1.0 ug/ml.

LDHA Rabbit Polyclonal Antibody

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. LDHA is supported by BioGPS gene expression data to be expressed in HeLa.

LDHA Rabbit Polyclonal Antibody

LDHA was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb582474 with 1:200 dilution. Western blot was performed using orb582474 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: LDHA IP with orb582474 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

LDHA Rabbit Polyclonal Antibody

Rabbit Anti-LDHA Antibody, Catalog Number: orb582474, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

LDHA Rabbit Polyclonal Antibody

WB Suggested Anti-LDHA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005557

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

LDHA Rabbit Polyclonal Antibody (orb582474)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry