CSF1 Rabbit Polyclonal Antibody

• Catalog Number: orb325140
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CSF1
• Target: CSF1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CSF1
• Protein Sequence: Synthetic peptide located within the following region: MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP
• UniProt ID: P09603
• MW: 57kDa
• Tested applications: ICC, IF, IHC-P, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti MCSF antibody, anti MGC31930 antibody, anti C
• Research Area: Cell Biology, Stem Cell & Developmental Biology
• Note: For research use only
• NCBI: NP_000748
• Expiration Date: 12 months from date of receipt.

CSF1 (orb325140) CSF1 in human placenta was detected using HRP/AEC red color stain, Working Dilution: 10 ug/mL.

WB Suggested Anti-CSF1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: COLO205 cell lysate.