CSF1 Rabbit Polyclonal Antibody

• Catalog Number: orb325139
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CSF1
• Target: CSF1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Guinea pig, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CSF1
• Protein Sequence: Synthetic peptide located within the following region: PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
• UniProt ID: Q5VVF3
• MW: 45kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti MCSF antibody, anti MGC31930 antibody, anti C
• Research Area: Cell Biology, Signal Transduction, Stem Cell & Dev
• Note: For research use only
• NCBI: NP_757349
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-CSF1 Antibody, Catalog Number: orb325139, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 – 2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-CSF1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.

WB Suggested Anti-CSF1 antibody Titration: 1 ug/mL, Sample Type: Human liver.