Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CPT1A Rabbit Polyclonal Antibody

SKU: orb579286

Description

Rabbit polyclonal antibody to CPT1A

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CPT1A
TargetCPT1A
Protein SequenceSynthetic peptide located within the following region: LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN
Molecular Weight88 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CPT1, CPT1-L, L-CPT1

Similar Products

  • Cpt1a Rabbit Polyclonal Antibody [orb385457]

    ICC,  IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • CPT1A Rabbit Polyclonal Antibody [orb1098014]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • CPT1A Rabbit Polyclonal Antibody [orb13352]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P

    Human, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • CPT1A Rabbit Polyclonal Antibody [orb626010]

    ELISA,  FC,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • CPT1A Antibody (C-term) [orb1931580]

    IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CPT1A Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml.

CPT1A Rabbit Polyclonal Antibody

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/ml.

CPT1A Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/ml.

CPT1A Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/ml.

CPT1A Rabbit Polyclonal Antibody

Sample Tissue: Human MDA-MB-435s Whole Cell, Antibody Dilution: 1 ug/ml.

CPT1A Rabbit Polyclonal Antibody

Sample Tissue: Human Stomach Tumor, Antibody Dilution: 1 ug/ml.

CPT1A Rabbit Polyclonal Antibody

Sample Type: 293T, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

CPT1A Rabbit Polyclonal Antibody

Lanes: 1. 45 ug capan1 cell lysate, 2. 45 ug HPAF cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: CPT1A.

CPT1A Rabbit Polyclonal Antibody

Sample Type: Human Capan1 cells (Pancreatic cancer cell line), Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-AlexaFluor-488, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: CPT1A: Green DAPI: Blue, Gene Name: CPT1A.

CPT1A Rabbit Polyclonal Antibody

WB Suggested Anti-CPT1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

CPT1A Rabbit Polyclonal Antibody (orb579286)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry