You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb333723 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Apolipoprotein E |
Target | APOE |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: LMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVC |
UniProt ID | P02649 |
MW | 36 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | Anti-AD2 antibody, Anti-Apo-E antibody, Anti-APOE Read more... |
Note | For research use only |
NCBI | NP_000032 |
Sample Type: 2. mouse brain extracts (80 ug), 3. rat brain extract (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
APOE antibody - N-terminal region (orb333723) validated by WB using 721_B cell lysate at 1.0 ug/ml. There is BioGPS gene expression data showing that APOE is expressed in 721_B.
Application: IHC, Species+tissue/cell type: Mouse brain stem cells, Primary antibody dilution: 1:500, Secondary antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000.
IHC, WB | |
Human | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |