Cart summary

You have no items in your shopping cart.

APOE Rabbit Polyclonal Antibody

SKU: orb333722

Description

Rabbit polyclonal antibody to Apolipoprotein E

Research Area

Cell Biology, Immunology & Inflammation, Neuroscience, Pharmacology & Drug Discovery, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse, Rat
Predicted ReactivityHuman

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human APOE
TargetAPOE
Protein SequenceSynthetic peptide located within the following region: KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF
Molecular Weight36 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Anti-AD2 antibody, Anti-Apo-E antibody, Anti-APOE antibody, Anti-APOE_HUMAN antibody, Anti-APOEA antibody, Anti-Apolipoprotein E antibody, Anti-Apolipoprotein E3 antibody, Anti-ApolipoproteinE antibody, Anti-Apoprotein antibody, Anti-LDLCQ5 antibody, Anti-LPG antibody

Similar Products

  • Apolipoprotein E Rabbit Polyclonal Antibody [orb1144]

    IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Apolipoprotein E/APOE Rabbit Polyclonal Antibody [orb371720]

    ICC,  IF,  IHC,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Apolipoprotein E/APOE Rabbit Polyclonal Antibody [orb251510]

    ELISA,  FC,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • APOE Rabbit Polyclonal Antibody [orb333723]

    IHC,  WB

    Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • APOE Rabbit Polyclonal Antibody [orb1728137]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

APOE Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

APOE Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell and tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

APOE Rabbit Polyclonal Antibody

Anti-APOE / Apolipoprotein E antibody IHC staining of human adrenal. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

APOE Rabbit Polyclonal Antibody

Anti-APOE / Apolipoprotein E antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

APOE Rabbit Polyclonal Antibody

APOE antibody - N-terminal region (orb333722) validated by WB using Fetal liver cell lysate at 1 ug/ml.

APOE Rabbit Polyclonal Antibody

APOE antibody - N-terminal region (orb333722), Catalog Number: orb333722, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm and membrane of hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

APOE Rabbit Polyclonal Antibody

Sample Tissue: Human Liver Tumor, Antibody dilution: 1 ug/ml.

APOE Rabbit Polyclonal Antibody

Sample Tissue: Human Liver Tumor, Antibody dilution: 3 ug/ml.

APOE Rabbit Polyclonal Antibody

Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.

APOE Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000032

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

APOE Rabbit Polyclonal Antibody (orb333722)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry