Cart summary

You have no items in your shopping cart.

APOE Rabbit Polyclonal Antibody

Catalog Number: orb333722

DispatchUsually dispatched within 1 - 2 weeks
$ 600.00
Catalog Numberorb333722
CategoryAntibodies
DescriptionRabbit polyclonal antibody to Apolipoprotein E
TargetAPOE
ClonalityPolyclonal
Species/HostRabbit
ConjugationUnconjugated
ReactivityHuman, Mouse, Rat
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human APOE
Protein SequenceSynthetic peptide located within the following region: KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF
UniProt IDP02649
MW36 kDa
Tested applicationsIHC, WB
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Alternative namesAnti-AD2 antibody, Anti-Apo-E antibody, Anti-APOE
Read more...
NoteFor research use only
NCBINP_000032
APOE Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

APOE Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell and tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

APOE Rabbit Polyclonal Antibody

Anti-APOE / Apolipoprotein E antibody IHC staining of human adrenal. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

APOE Rabbit Polyclonal Antibody

Anti-APOE / Apolipoprotein E antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

APOE Rabbit Polyclonal Antibody

APOE antibody - N-terminal region (orb333722) validated by WB using Fetal liver cell lysate at 1 ug/ml.

APOE Rabbit Polyclonal Antibody

APOE antibody - N-terminal region (orb333722), Catalog Number: orb333722, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm and membrane of hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

APOE Rabbit Polyclonal Antibody

Sample Tissue: Human Liver Tumor, Antibody dilution: 1 ug/ml.

APOE Rabbit Polyclonal Antibody

Sample Tissue: Human Liver Tumor, Antibody dilution: 3 ug/ml.

APOE Rabbit Polyclonal Antibody

Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.

APOE Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

  • Apolipoprotein E Rabbit Polyclonal Antibody [orb1144]

    IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • APOE Rabbit Polyclonal Antibody [orb333723]

    IHC,  WB

    Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Anti-Apolipoprotein E Antibody [orb213571]

    IF,  IH,  WB

    Human, Mouse, Primate, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl
  • ApoE rabbit pAb [orb768721]

    ELISA,  IHC-P,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Apolipoprotein E4 Rabbit Polyclonal Antibody [orb4524]

    IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl