ACTB Rabbit Polyclonal Antibody

SKU: orb577463

Description

ACTB Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ACTB. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of Human ACTB. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Equine, Goat, Porcine, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Equine, Goat, Porcine, Rat, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ACTB
• Target: ACTB
• Protein Sequence: Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK
• Molecular Weight: 42kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

BRWS1, PS1TP5BP1

1. The sample 1 - 8 is used N2 wild type C. elegans. 2. Each lane contain 60 ug of sample and the loading volume is 36 ul. 3. The number 1 sample is a control without any treatment. 4. As I get 50 ug of primary Ab, I diluted with 50 ul of water. I use 5 ul each time in 10 ml of 5% milk in PBST buffer. 5. The secondary antibody for chemiluminescence is Peroxidase-AffiniPure Goat Anti-Rabbit IgG (H+L); for the chromogenic detection, I used goat anti-rabbit IgG-Ap (sc-2007).

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human HepG2, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.

Sample Type: Hela, Antibody Dilution: 1.0 ug/ml. ACTB is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.

Sample Type: HepG2 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml. ACTB is strongly supported by BioGPS gene expression data to be expressed in HepG2.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/ml. ACTB is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. ACTB is strongly supported by BioGPS gene expression data to be expressed in MCF7.

Sample Type: Fetal Lung lysates, Antibody Dilution: 1 ug/ml.

IHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.

Rabbit Anti-ACTB Antibody, Catalog Number: orb577463, Formalin Fixed Paraffin Embedded Tissue: Human Appendix (Colon) Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Sample type: 1-8.N2 WT C elegans (60 ug), Primary Dilution: 1:2000, Secondary Antibody: goat anti-Rabbit HRP, Secondary Dilution: 1:2000.

Sample Type: Human brain stem cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: ACTB: Red DAPI:Blue, Gene Name: ACTB.

WB Suggested Anti-ACTB Antibody, Positive Control: Lane 1: 30 ug mouse 3T3 ECM extract + blocking peptide, Lane 2: 30 ug mouse 3T3 ECM extract, Lane 3: 30 ug Echinococcus granulosus extract, Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:10000.

WB Suggested Anti-ACTB Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Transfected 293T.

Quick Database Links

Gene Symbol

ACTB

UniProt

P60709

RefSeq (Protein):NP_001092